DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and CG12448

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_723942.2 Gene:CG12448 / 34942 FlyBaseID:FBgn0028857 Length:352 Species:Drosophila melanogaster


Alignment Length:257 Identity:76/257 - (29%)
Similarity:137/257 - (53%) Gaps:9/257 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIAARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIR 66
            |.|||.||...||:..|..|..:..:|..|.:|||||..||..:..:::.||..|.::.|..|.:
  Fly    64 FNAARTIQCHVRGFLARSTLKRQIDAATIISKWWRGFWVRHSKFSFMQQLLQQRIIQYHHDMATK 128

  Fly    67 IQALFRGWWVRKFIHDVRNLHRMQCTAAEDLINCIIHEMHHIKKTDSIPGVISLRNSVCRSKVEK 131
            ||||||||..|::..|.:.:..::....||:::.:..::|.::|...:||:.:||.|...||:|.
  Fly   129 IQALFRGWMTRQYFQDFQGMKSLRIQYVEDMLSSLYRKVHRMRKEHMLPGIYALRESDLLSKIED 193

  Fly   132 LLTTMIFRFHNGRVLSMVANRMSQKEEYRRHFRDARFVTHIPYSGPNFDGLCYVREDDHIVLKEV 196
            |.:|..:|||||||.:.:|.:.|...:.|..||.....:.:||.||..:.:    .|....|.:.
  Fly   194 LSSTFGYRFHNGRVRAAIAMKRSFINDRRHEFRKGNTYSKVPYPGPYIENI----NDLEFTLPKR 254

  Fly   197 PTDLRYSEIVTEYEESQLHEHLRETHLRFDLRKLQRQIDHINYQELHLKRKFCADVIDRMRK 258
            .|. |....:..|:::...:::.:.::.:..::  |...|:..:  :::.:||.|.:.|:.|
  Fly   255 MTP-RLQRTILVYDKAMRDKNVEKVYMNYSTKR--RMSMHVMRE--NMRNRFCKDFVKRLAK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 32/74 (43%)
CG12448NP_723942.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014388
OrthoInspector 1 1.000 - - otm47562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.