DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and SPATA17

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001362584.1 Gene:SPATA17 / 128153 HGNCID:25184 Length:361 Species:Homo sapiens


Alignment Length:312 Identity:74/312 - (23%)
Similarity:124/312 - (39%) Gaps:71/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AARRIQSFWRGYRVRKLL-HLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRI 67
            ||.:|||::||.:||..: ||. :....||:|||.|..|......|:.....::...::..|:||
Human    35 AAVKIQSWFRGCQVRAYIRHLN-RIVTIIQKWWRSFLGRKQYQLTVQVAYYTMMMNLYNAMAVRI 98

  Fly    68 QALFRGWWVRKFIHDVRNLHRMQCTAAE--DLINCIIHE-------------------------- 104
            |..:||:.|||::.:...|.......:|  |.|...:.|                          
Human    99 QRRWRGYRVRKYLFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQAR 163

  Fly   105 -MHHIKKTDSIPGVISLRNSVCRSKVEKLLTTMIFRFHNGRVLSMVANRMSQKEE---------- 158
             ||::..|..|||:.   ||..|.:.:    ....:....:.|:....::.||:.          
Human   164 KMHYLLSTKQIPGIY---NSPFRKEPD----PWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACT 221

  Fly   159 YRRHFRDARFVTHI---PYSGPNFDGLCYVREDDHIVLKEVPTDLRYSEIVTEY----EESQLHE 216
            ..|.|..:..:..|   ...|| |..:..|.|..:..|:  || ||.:|.:.|.    ||.:..|
Human   222 SARSFPRSEILPPINRKQCQGP-FRDITEVLEQRYRPLE--PT-LRVAEPIDELKLAREELRREE 282

  Fly   217 HLRETH----LRF-DLRKLQRQID--HIN--YQELHLKRKFCADVIDRMRKW 259
            .|:..:    |.| ...|.::.|.  |::  |..:..|.:|.:   :..:||
Human   283 WLQNVNDNMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRS---ENPKKW 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 27/75 (36%)
SPATA17NP_001362584.1 IQ 55..76 CDD:197470 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104978
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.600

Return to query results.
Submit another query.