Sequence 1: | NP_723937.3 | Gene: | CG31735 / 318922 | FlyBaseID: | FBgn0051735 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031757738.1 | Gene: | spata17 / 100490367 | XenbaseID: | XB-GENE-987841 | Length: | 358 | Species: | Xenopus tropicalis |
Alignment Length: | 265 | Identity: | 64/265 - (24%) |
---|---|---|---|
Similarity: | 104/265 - (39%) | Gaps: | 60/265 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 AARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRIQ 68
Fly 69 ALFRGWWVRKFIHDVRNLHR-MQCTAAEDLINCII------------------------------ 102
Fly 103 -HEMHHIKKTDSIPGVISLRNSVCRSKVEKLLTTMIFRFHNGRVLSMVANRMSQKEEYRRHFRDA 166
Fly 167 RFVTHIPY------------SGPNFDGLCYVREDDHIVLKEVPTDLRYSEIVTEYEESQLHEHLR 219
Fly 220 ETHLR 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31735 | NP_723937.3 | COG5022 | <4..>79 | CDD:227355 | 27/74 (36%) |
spata17 | XP_031757738.1 | IQ | 55..76 | CDD:197470 | 7/20 (35%) |
COG5022 | <74..>136 | CDD:227355 | 17/64 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm47562 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X6126 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |