DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and spata17

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_031757738.1 Gene:spata17 / 100490367 XenbaseID:XB-GENE-987841 Length:358 Species:Xenopus tropicalis


Alignment Length:265 Identity:64/265 - (24%)
Similarity:104/265 - (39%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRIQ 68
            ||..|||::||.:||..|....:....||:||||:..|.....||:.....:....::..|:|||
 Frog    35 AAVAIQSWFRGCQVRAYLRYLHKMVTVIQKWWRGYVARKYFRSKVKTAYFIMKMNFYNEMAVRIQ 99

  Fly    69 ALFRGWWVRKFIHDVRNLHR-MQCTAAEDLINCII------------------------------ 102
            ..:||::|||::|:...|.| ::..|.:   |.|:                              
 Frog   100 KRWRGYFVRKYVHNYYALKRYLEGVAIK---NNIVRKELDKYADIKSREQAKKKMENEEREKEYH 161

  Fly   103 -HEMHHIKKTDSIPGVISLRNSVCRSKVEKLLTTMIFRFHNGRVLSMVANRMSQKEEYRRHFRDA 166
             .:||::..|:.:||:.:       |.......:|..|....|.||.....|.:.|.....:.|.
 Frog   162 ARKMHYLLSTEQVPGIYN-------SPYRPFPDSMEIRLQKARPLSHKDRPMEKPENPDLLYSDC 219

  Fly   167 RFVTHIPY------------SGPNFDGLCYVREDDHIVLKEVPTDLRYSEIVTEYEESQLHEHLR 219
            |.....|.            .|| |.....|.:..:..|:  || ||.:..::..||::  |.|:
 Frog   220 RDAFSFPIMQPLPPIGMKRPQGP-FRDTAEVLQQRYKPLE--PT-LRVATSISSVEEAR--EELK 278

  Fly   220 ETHLR 224
            ....|
 Frog   279 RQEWR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 27/74 (36%)
spata17XP_031757738.1 IQ 55..76 CDD:197470 7/20 (35%)
COG5022 <74..>136 CDD:227355 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47562
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.