DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and ARD1

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_011877.1 Gene:ARD1 / 856404 SGDID:S000001055 Length:238 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:52/198 - (26%)
Similarity:81/198 - (40%) Gaps:56/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIA--------------------- 46
            :.|....:|:..:.:.....|.|.|.:.:::.|.|.:|..|.:|                     
Yeast     4 NIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQDENDKLEL 68

  Fly    47 -----------------IAPGPDGRPMGYIFGQYQVKRNQD-------PYGHVAALTVSPEYRRL 87
                             :|||.  :.:||:.    ||.|.|       |.||:.:|:|...|||:
Yeast    69 TLDGTNDGRTIKLDPTYLAPGE--KLVGYVL----VKMNDDPDQQNEPPNGHITSLSVMRTYRRM 127

  Fly    88 GLATALM-DFFFMVSDLKGASYVNLFMRISNRAAYQLY-TSLGYAHRQTFLDYYPDEPKPESAYE 150
            |:|..|| ...|.:.::..|.||:|.:|.|||||..|| .:|.:........||.|   .|.||.
Yeast   128 GIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQD---GEDAYA 189

  Fly   151 LRK 153
            ::|
Yeast   190 MKK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 46/178 (26%)
Acetyltransf_1 52..129 CDD:278980 32/85 (38%)
ARD1NP_011877.1 RimI 1..192 CDD:223532 51/196 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S458
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.660

Return to query results.
Submit another query.