DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and Nat8f5

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_075982.2 Gene:Nat8f5 / 69049 MGIID:1916299 Length:227 Species:Mus musculus


Alignment Length:52 Identity:17/52 - (32%)
Similarity:30/52 - (57%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGY 129
            |:||.::|..|:|.||:...|..:..:|.|.|.|...:..::|..||.::|:
Mouse   141 LSVSSQHRGQGIAKALVRTVFQFARDQGYSDVVLETSVIQQSAITLYEAMGF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 17/52 (33%)
Acetyltransf_1 52..129 CDD:278980 16/50 (32%)
Nat8f5NP_075982.2 RimI <125..196 CDD:223532 17/52 (33%)
Acetyltransf_1 <136..193 CDD:278980 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.