DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and NAA20

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_057184.1 Gene:NAA20 / 51126 HGNCID:15908 Length:178 Species:Homo sapiens


Alignment Length:168 Identity:69/168 - (41%)
Similarity:104/168 - (61%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQ- 64
            ||:.|....||||:.|::..|.|||.|.:.|::::...:|....:|.|||  |..||||.|:.: 
Human     1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPG--GELMGYIMGKAEG 63

  Fly    65 -VKRNQDPYGHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLG 128
             |.| ::.:|||.||:|:||:||||||..||:....:|:.||..:|:||:|:||:.|..:|..||
Human    64 SVAR-EEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLG 127

  Fly   129 YAHRQTFLDYY------PDEPKPESAYELRKYVPRPME 160
            |:..:|.::||      ||    |.||::||.:.|..|
Human   128 YSVYRTVIEYYSASNGEPD----EDAYDMRKALSRDTE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 57/139 (41%)
Acetyltransf_1 52..129 CDD:278980 36/78 (46%)
NAA20NP_057184.1 RimI 1..156 CDD:223532 67/161 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D1355894at2759
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.