DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and naa10

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_998499.1 Gene:naa10 / 406643 ZFINID:ZDB-GENE-040426-2648 Length:224 Species:Danio rerio


Alignment Length:154 Identity:51/154 - (33%)
Similarity:80/154 - (51%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQVKR 67
            :.|..|.:||..:.......|.|.|.:.::..|.|.:|.||.  ||...:|:.:||:..:.:...
Zfish     2 NIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSY--IAEDENGKIVGYVLAKMEEDP 64

  Fly    68 NQDPYGHVAALTVSPEYRRLGLATALMD--FFFMVSDLKGASYVNLFMRISNRAAYQLYT-SLGY 129
            :..|:||:.:|.|...:||||||..|||  ...|:.:. .|.||:|.:|.|||||..||: :|.:
Zfish    65 DDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENF-NAKYVSLHVRKSNRAALHLYSNTLKF 128

  Fly   130 AHRQTFLDYYPDEPKPESAYELRK 153
            ...:....||.|   .|.||.:::
Zfish   129 QISEVEPKYYAD---GEDAYAMKR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 45/134 (34%)
Acetyltransf_1 52..129 CDD:278980 31/79 (39%)
naa10NP_998499.1 RimI 1..151 CDD:223532 51/154 (33%)
Acetyltransf_1 47..122 CDD:278980 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.