DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and vnc

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_648378.1 Gene:vnc / 39175 FlyBaseID:FBgn0263251 Length:196 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:74/148 - (50%) Gaps:9/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQ--VKRNQDPY 72
            :||..:.......|.|.|.:.::..|.|.:|.||.:|:  ...|..:||:..:.:  ....:..:
  Fly     9 EDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAV--DDKGAIVGYVLAKMEEPEPNEESRH 71

  Fly    73 GHVAALTVSPEYRRLGLATALMDFFFM-VSDLKGASYVNLFMRISNRAAYQLYT-SLGYAHRQTF 135
            ||:.:|.|...|||||||..||:.... :.:...|.||:|.:|.|||||..||| :|.:...:..
  Fly    72 GHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVE 136

  Fly   136 LDYYPDEPKPESAYELRK 153
            ..||.|   .|.||.:|:
  Fly   137 PKYYAD---GEDAYAMRR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 43/134 (32%)
Acetyltransf_1 52..129 CDD:278980 30/80 (38%)
vncNP_648378.1 RimI 1..151 CDD:223532 47/146 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466537
Domainoid 1 1.000 41 1.000 Domainoid score I768
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.