DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and Naa60

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster


Alignment Length:176 Identity:38/176 - (21%)
Similarity:64/176 - (36%) Gaps:46/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMRF---DDLFKINSLV---------------------FDALTEVYSLT---FFVKHFLEFPGLS 43
            ::||   |||.::..|.                     |.||..||:|.   ..|.....:..::
  Fly    35 QLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVN 99

  Fly    44 QIAIAPGPD---------GRPM---GYIFGQYQVKRNQDPYGHVAALTVSPEYRRLGLATALMDF 96
            :..||...|         |.||   |.:  ...:.|:.| .|::.:|.|...:||.|:.:.|:|.
  Fly   100 KEVIANMSDSDELYTRLSGFPMQDKGIL--PDSMGRSAD-VGYILSLGVHRSHRRNGIGSLLLDA 161

  Fly    97 F---FMVSDLKGASYVNLFMRISNRAAYQLYTSLGYAHRQTFLDYY 139
            .   ...::......:.|....:|:.|...|....:. ..:||.||
  Fly   162 LMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFT-LHSFLPYY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 37/173 (21%)
Acetyltransf_1 52..129 CDD:278980 19/91 (21%)
Naa60NP_996032.1 RimI 74..207 CDD:223532 31/137 (23%)
Acetyltransf_1 <136..198 CDD:278980 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.