DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and Naa20A

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:73/158 - (46%)
Similarity:104/158 - (65%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQV 65
            ||:.|....|||||.|::.||.|||.|.|:|:.::..::|...|  :|..|.|:.||||.|  :|
  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQ--LAESPSGQIMGYIMG--KV 61

  Fly    66 KRNQDP-YGHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGY 129
            :.:.|. :|||.||||||:|||||||..||.|...:|:.|.|.:|:||:|.||:.|..:||:|||
  Fly    62 EGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGY 126

  Fly   130 AHRQTFLDYYPDEPKPESAYELRKYVPR 157
            ...:|.|:||..: :.|.||::||.:.|
  Fly   127 IIYRTILEYYSGD-QDEDAYDMRKALSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 64/132 (48%)
Acetyltransf_1 52..129 CDD:278980 40/77 (52%)
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 72/154 (47%)
Acetyltransf_1 51..126 CDD:278980 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452069
Domainoid 1 1.000 41 1.000 Domainoid score I768
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D121425at6656
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.