DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and Naa11

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001019913.1 Gene:Naa11 / 289482 RGDID:1564723 Length:246 Species:Rattus norvegicus


Alignment Length:154 Identity:52/154 - (33%)
Similarity:80/154 - (51%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQVKR 67
            :.|..|.:||..:.......|.|.|.:.::..|.|.:|.||.  ||...||:.:||:..:.:...
  Rat     2 NIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSY--IAEDEDGKIVGYVLAKMEEDP 64

  Fly    68 NQDPYGHVAALTVSPEYRRLGLATALMD--FFFMVSDLKGASYVNLFMRISNRAAYQLYT-SLGY 129
            :..|:||:.:|.|...:||||||..|||  ...|:.:. .|.||:|.:|.|||||..||: :|.:
  Rat    65 DDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENF-SAKYVSLHVRKSNRAALHLYSNTLNF 128

  Fly   130 AHRQTFLDYYPDEPKPESAYELRK 153
            ...:....||.|   .|.||.:::
  Rat   129 QVSEVEPKYYAD---GEDAYAMKR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 46/134 (34%)
Acetyltransf_1 52..129 CDD:278980 32/79 (41%)
Naa11NP_001019913.1 RimI 1..153 CDD:223532 52/154 (34%)
Interaction with NAA15. /evidence=ECO:0000250 1..58 18/57 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.