DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and Naa50

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001296733.1 Gene:Naa50 / 288108 RGDID:1310944 Length:169 Species:Rattus norvegicus


Alignment Length:153 Identity:38/153 - (24%)
Similarity:73/153 - (47%) Gaps:20/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIA----IAPGPDGRPMGYIFGQYQVKRNQDPY 72
            |.::|.::|..   .|:..|: |..||...|:::|    ||       :|.:..:....:||...
  Rat    19 LKRLNQVIFPV---SYNDKFY-KDVLEVGELAKLAYFNDIA-------VGAVCCRVDHSQNQKRL 72

  Fly    73 GHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFM--RISNRAAYQLYTSLGYAHRQTF 135
             ::..|.....|||||:.|.:::....:.: |..::.|:::  :|||.:|...|...|:...:|.
  Rat    73 -YIMTLGCLAPYRRLGIGTKMLNHVLNICE-KDGTFDNIYLHVQISNESAIDFYRKFGFEIIETK 135

  Fly   136 LDYYPDEPKPESAYELRKYVPRP 158
            .:|| ...:|..|:.|:|.:..|
  Rat   136 KNYY-KRIEPADAHVLQKSLRVP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 33/134 (25%)
Acetyltransf_1 52..129 CDD:278980 17/78 (22%)
Naa50NP_001296733.1 RimI 10..145 CDD:223532 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.