DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and naa20

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_587922.1 Gene:naa20 / 2539279 PomBaseID:SPCC16C4.12 Length:180 Species:Schizosaccharomyces pombe


Alignment Length:158 Identity:54/158 - (34%)
Similarity:92/158 - (58%) Gaps:2/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQV 65
            ||..|:.:..|||..|::..|.|||.::::|::.:..::|.|..:..:...|...||||.|:.: 
pombe     1 MTDTRKFKATDLFSFNNINLDPLTETFNISFYLSYLNKWPSLCVVQESDLSDPTLMGYIMGKSE- 64

  Fly    66 KRNQDPYGHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGYA 130
            ...::.:.||.|:||:|..||||||..:||:...|.:.:.|.:|:||:|.||..|...|..|||:
pombe    65 GTGKEWHTHVTAITVAPNSRRLGLARTMMDYLETVGNSENAFFVDLFVRASNALAIDFYKGLGYS 129

  Fly   131 HRQTFLDYYPD-EPKPESAYELRKYVPR 157
            ..:..:.||.: ..|.|.::::||.:.|
pombe   130 VYRRVIGYYSNPHGKDEDSFDMRKPLSR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 46/131 (35%)
Acetyltransf_1 52..129 CDD:278980 31/76 (41%)
naa20NP_587922.1 RimI 1..155 CDD:223532 53/154 (34%)
Acetyltransf_1 52..128 CDD:278980 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.