DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31730 and F16B12.1

DIOPT Version :9

Sequence 1:	NP_723799.1	Gene:	CG31730 / 318920	FlyBaseID:	FBgn0051730	Length:	162	Species:	Drosophila melanogaster
Sequence 2:	NP_001359593.1	Gene:	F16B12.1 / 181519	WormBaseID:	WBGene00008879	Length:	686	Species:	Caenorhabditis elegans

Alignment Length:	140	Identity:	30/140 - (21%)
Similarity:	47/140 - (33%)	Gaps:	61/140 - (43%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 SFREMRFDDLFKINSLVFDALTEVYSLTFFVK----------------HFLEFPGLSQIAIAP-- 49
            ||.....|:|  |.|:.:..:.|.|..||.||                .|.|. .::|..|.|
Worm   322 SFTIAHSDEL--IRSVAYKEVAEHYDTTFVVKQQTLLISYQSEDKYYRRFFEV-NVTQKMIDPDC 383

  Fly    50 ----------GPDGRPM--------GYIFGQYQVKRNQDPYGHVAALTVSPEYRRLGLATALMDF 96
                      ..:|:.:        .||:..:|.|.::         :.||        .:::||
Worm   384 SCNFFNDKTFSSEGKMLNLSFPAHCAYIYCHFQFKDSR---------SYSP--------GSVLDF 431

  Fly    97 FFMVSDLKGA 106
                 .||||
Worm   432 -----QLKGA 436

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31730	NP_723799.1	rimI	9..141	CDD:273701	28/134 (21%)
CG31730	NP_723799.1	Acetyltransf_1	52..129	CDD:278980	13/63 (21%)
F16B12.1	NP_001359593.1	CUB	24..118	CDD:214483
F16B12.1	NP_001359593.1	CUB	515..612	CDD:238001
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0456
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900