DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and Nat8b

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_598242.1 Gene:Nat8b / 171084 RGDID:621605 Length:222 Species:Rattus norvegicus


Alignment Length:90 Identity:23/90 - (25%)
Similarity:35/90 - (38%) Gaps:19/90 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PDGRPMGYIFGQYQVKRNQDPYGHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRI 115
            |.||....:|             |:|   ||.::|..|:|.||:......:..:|.:.|.|....
  Rat   131 PSGRKQLQLF-------------HLA---VSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETST 179

  Fly   116 SNRAAYQLYTSLGYAHRQTFLDYYP 140
            ....|..||..:|:   |....|:|
  Rat   180 MQIGAVTLYLGMGF---QKTGQYFP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 23/90 (26%)
Acetyltransf_1 52..129 CDD:278980 18/76 (24%)
Nat8bNP_598242.1 hydrophobic domain 36..80
Acetyltransf_1 91..193 CDD:395465 19/77 (25%)
consensus motif D 109..126
consensus motif A 131..166 13/50 (26%)
consensus motif B 174..194 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.