DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31730 and NAA30

DIOPT Version :9

Sequence 1:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001011713.2 Gene:NAA30 / 122830 HGNCID:19844 Length:362 Species:Homo sapiens


Alignment Length:137 Identity:37/137 - (27%)
Similarity:69/137 - (50%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMRFDDLFKINSLVFDALTEVYSLTFFVKHFL-EFPGLSQIAIAPGPDGRPMGYIFGQYQVKRNQ 69
            |::..|:.:   |:...|:|.||: :..::|: .:|.|..:|:. |.:  .:|.|..:..:.:..
Human   221 ELQMPDIMR---LITKDLSEPYSI-YTYRYFIHNWPQLCFLAMV-GEE--CVGAIVCKLDMHKKM 278

  Fly    70 DPYGHVAALTVSPEYRRLGLATALMD--FFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGYAHR 132
            ...|::|.|.|..:|||.|:.|.|:.  .:.||..  ....|.|...|:|::|.:||.:||:...
Human   279 FRRGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEG--DCDEVVLETEITNKSALKLYENLGFVRD 341

  Fly   133 QTFLDYY 139
            :....||
Human   342 KRLFRYY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31730NP_723799.1 rimI 9..141 CDD:273701 36/134 (27%)
Acetyltransf_1 52..129 CDD:278980 22/78 (28%)
NAA30NP_001011713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..88
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..182
RimI 209..362 CDD:223532 37/137 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.