DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and SNT2

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_011384.1 Gene:SNT2 / 852746 SGDID:S000003099 Length:1403 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:45/218 - (20%)
Similarity:76/218 - (34%) Gaps:76/218 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 FGYHAGFNHGFNCAE-STNFAMERWIEYGKRAVQCT--CSNDMVKISMDTFVKR--FQSDRYDLW 330
            :.||      ..||: |:||.:  ..|....:|..|  |..| ||:: ||:..|  ...||:|:.
Yeast  1197 YRYH------ITCAQNSSNFKL--MFEKKNMSVDTTLPCIKD-VKLN-DTYTLRPILICDRHDIS 1251

  Fly   331 MEGRDVG---------------------------------------RHPEDPPNAVLSAAPLPPH 356
            :||.::.                                       ||.|.|.|:..||  :.|.
Yeast  1252 LEGNELYPLSYKPQHTLSYIEQYCRYYKCESDHSLVELRYFEQLRLRHGEMPGNSHDSA--IKPK 1314

  Fly   357 LDVLLCDKKMKKQCNPTKAK-----------SFKERNPDLDLD----EIQQNPNVPDDVKAMLKE 406
            :.||..::.. ..|...|:.           :.:....:||.|    .|..:..:|.::...|.|
Yeast  1315 IYVLPFERTC-PHCGTNKSLYWYEDIICHSCNLRSGAQELDFDSASANISNDNGLPVEITQQLME 1378

  Fly   407 SV----LTLDTGDLATDEADFPN 425
            .:    ..:|..:..||:...|:
Yeast  1379 GIEPAMFDIDISEAGTDKNTHPS 1401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224 5/18 (28%)
SNT2NP_011384.1 BAH_fungalPHD 112..256 CDD:240061
PHD1_Snt2p_like 319..366 CDD:276972
Myb_DNA-binding 559..602 CDD:395191
PHD2_Snt2p_like 1040..1094 CDD:276973
ePHD_Snt2p_like 1108..1248 CDD:277137 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.