DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and JADE1

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_024309986.1 Gene:JADE1 / 79960 HGNCID:30027 Length:857 Species:Homo sapiens


Alignment Length:153 Identity:40/153 - (26%)
Similarity:53/153 - (34%) Gaps:38/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 RNNRGRSPRTKDD-------RSISPASSTSSTSR---GARRGKASGTPRKTPARRKK------DS 535
            |:||......|.|       :|..|..||..:.|   ..|...:.|..:..|..||:      .|
Human   675 RDNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRAATSPGVGQSAPGTRKEIVPKCNGS 739

  Fly   536 ITTSPAVSSAATAVKTPTSAVVAGTTSIATTTTPPADGGG---DAKKERQSLQFMQQSRKFEGKI 597
            :.   .|:...||||.||           |..:|..:.||   ..|.|||     ||....:|..
Human   740 LI---KVNYNQTAVKVPT-----------TPASPVKNWGGFRIPKKGERQ-----QQGEAHDGAC 785

  Fly   598 PKLSQTSAATGGATAAAEASTSK 620
            .:.|.......|...|.|.:.||
Human   786 HQHSDYPYLGLGRVPAKERAKSK 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
JADE1XP_024309986.1 EPL1 114..>544 CDD:331339
ePHD_JADE1 270..387 CDD:277174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.