DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and Brpf1

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_006506845.1 Gene:Brpf1 / 78783 MGIID:1926033 Length:1253 Species:Mus musculus


Alignment Length:403 Identity:75/403 - (18%)
Similarity:147/403 - (36%) Gaps:123/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 MEGRDVGRHPEDPP--NAVLSAAPLPPHLDVLLCDKK------MKKQCNPTKAKSFKERNPDLDL 387
            ::.:|.|....:|.  :.|.....:|.:||.:   ||      ||:.....:..:|.:...|.:|
Mouse   643 LQEKDTGNIFSEPVPLSEVTELDEVPDYLDHI---KKPMDFFTMKQNLEAYRYLNFDDFEEDFNL 704

  Fly   388 -----------DEI---------QQNPNVPDDVKAMLKESVLTLDTG-----DLATDEADFPNED 427
                       |.|         :|...|....:...::..:..:||     :||.||.....||
Mouse   705 IVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHNLAGDEVSHHTED 769

  Fly   428 AMS------LQSPANLKTKQE---LLEYIDDGTEDDDEEEDFKRRKQKRRYDADYDDDWLASKRK 483
            |:.      |::..:|..:::   |||.:|:...........:|.|..::       :..|.:||
Mouse   770 AVEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKK-------EMTALRRK 827

  Fly   484 TNSRNNRGR--------------SPR----TKDDRSISPA--SSTSSTSRG-------------- 514
            ...:...||              :|.    .||.::.|.|  ||:..||:|              
Mouse   828 LAHQRETGRDGPERHGPSGRGNLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVG 892

  Fly   515 --------ARRGKASGTPRK--TPARRKKDSITTS-----------PAVSSAATAV--KTPTSAV 556
                    .:..|.:|.|::  .|.:.::..:|.|           |.:.|.....  ::|..:.
Mouse   893 RRTSVLFSKKNPKTAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMGSLRQRKRGRSPRPSS 957

  Fly   557 VAGTTSIATTTTPPAD------GGGDAKKERQSLQFMQQSRKFEGKIPKL---SQTSAATGGATA 612
            .:.:.|..:|..||.|      ..|:...::..|.:     :.:..:|:.   |::|:::..:.|
Mouse   958 SSDSDSDKSTEDPPMDLPANGFSSGNQPVKKSFLVY-----RNDCNLPRSSSDSESSSSSSSSAA 1017

  Fly   613 AAEASTSKSSQGQ 625
            :...||:.|.||:
Mouse  1018 SDRTSTTPSKQGR 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
Brpf1XP_006506845.1 SFP1 <20..50 CDD:227516
COG5141 173..656 CDD:227470 2/12 (17%)
ePHD_BRPF1 329..449 CDD:277171
Bromo_brd1_like 631..734 CDD:99944 17/93 (18%)
BR140_related 1122..1237 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.