DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and BRPF1

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_024309509.1 Gene:BRPF1 / 7862 HGNCID:14255 Length:1254 Species:Homo sapiens


Alignment Length:403 Identity:76/403 - (18%)
Similarity:147/403 - (36%) Gaps:123/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 MEGRDVGRHPEDPP--NAVLSAAPLPPHLDVLLCDKK------MKKQCNPTKAKSFKERNPDLDL 387
            ::.:|.|....:|.  :.|.....:|.:||.:   ||      ||:.....:..:|.:...|.:|
Human   644 LQEKDTGNIFSEPVPLSEVTELDEVPDYLDHI---KKPMDFFTMKQNLEAYRYLNFDDFEEDFNL 705

  Fly   388 -----------DEI---------QQNPNVPDDVKAMLKESVLTLDTG-----DLATDEADFPNED 427
                       |.|         :|...|....:...::..:..:||     .||.|||....||
Human   706 IVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTED 770

  Fly   428 A------MSLQSPANLKTKQE---LLEYIDDGTEDDDEEEDFKRRKQKRRYDADYDDDWLASKRK 483
            |      :.|::..:|..:::   |||.:|:...........:|.|..::       :..|.:||
Human   771 AAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKK-------EMTALRRK 828

  Fly   484 TNSRNNRGR------SPRTKDDRSISPA--------------SSTSSTSRG-------------- 514
            ...:...||      .|.::...:..||              ||:..||:|              
Human   829 LAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVG 893

  Fly   515 --------ARRGKASGTPRK--TPARRKKDSITTS-----------PAVSSAATAV--KTPTSAV 556
                    .:..|.:|.|::  .|.:.::..:|.|           |.:||.....  ::|..:.
Human   894 RRTSVLFSKKNPKTAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSS 958

  Fly   557 VAGTTSIATTTTPPAD------GGGDAKKERQSLQFMQQSRKFEGKIPKL---SQTSAATGGATA 612
            .:.:.|..:|..||.|      .||:...::..|.:     :.:..:|:.   |::|:::..:.|
Human   959 SSDSDSDKSTEDPPMDLPANGFSGGNQPVKKSFLVY-----RNDCSLPRSSSDSESSSSSSSSAA 1018

  Fly   613 AAEASTSKSSQGQ 625
            :...||:.|.||:
Human  1019 SDRTSTTPSKQGR 1031

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
BRPF1XP_024309509.1 SFP1 <20..52 CDD:227516
COG5141 174..657 CDD:227470 2/12 (17%)
ePHD_BRPF1 330..450 CDD:277171
Bromo_brd1_like 632..735 CDD:99944 17/93 (18%)
BR140_related 1123..1238 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.