DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and Jade2

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001344517.1 Gene:Jade2 / 76901 MGIID:1924151 Length:901 Species:Mus musculus


Alignment Length:278 Identity:66/278 - (23%)
Similarity:108/278 - (38%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DKKMK-----KQCNPTKAKSFKERNPDLDLDEIQQNPNVPDD---VKAMLKESVLTLDTGDLATD 419
            |.|.|     |..:|.|.:..| ..|:..|.::..:.:.|.|   ..:.|.:|| .:...|:|..
Mouse   602 DSKRKGREGPKGSSPEKKEKVK-AGPESVLGQLGLSTSFPIDGTFFNSWLAQSV-QITAEDMAMS 664

  Fly   420 E----ADFPNEDAMSLQSPANLKTKQELLEYI-DDGTEDDDEEEDFKRRKQKRRYDADYDDDWLA 479
            |    :....:.|..|.|...|:.::.||.:: |......|...  |.|.:.|          |.
Mouse   665 EWSLNSGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPAR--KARGRTR----------LP 717

  Fly   480 SKRKTNSRNNRGRSPRTKDDRSISPASSTSSTSRGARRGKASGTPRKTPARRKKDSITTSPAVSS 544
            :|:|.:...: |.|.||..|:  .|..:.:...:|.:     |.|.:.|.||....:.:|||...
Mouse   718 AKKKPSPLQD-GPSARTTPDK--QPKKAWAQDGKGTQ-----GPPMRKPPRRTSSHLPSSPAAGD 774

  Fly   545 A---ATAVKTP--TSAVVAGTTSIATTTTPPADGG-------GDAKKERQSLQFMQQSRKFEGKI 597
            .   ||....|  .|.::..|..:|:.......|.       |..:..|:    |:.|||..|  
Mouse   775 CPVPATLESPPPLASEILDKTAPMASDLNVQVPGPTVSPKPLGRLRPPRE----MKVSRKSPG-- 833

  Fly   598 PKLSQTSAATGGATAAAE 615
               :::.|.||..:|.||
Mouse   834 ---ARSDAGTGLPSAVAE 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
Jade2NP_001344517.1 EPL1 209..>578 CDD:331339
ePHD_JADE2 326..436 CDD:277175
Atrophin-1 <676..852 CDD:331285 49/202 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.