DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and Phf14

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_006236166.1 Gene:Phf14 / 500030 RGDID:1563764 Length:950 Species:Rattus norvegicus


Alignment Length:218 Identity:50/218 - (22%)
Similarity:86/218 - (39%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 DVLLCDK---KMKKQ------CNPTKAKSFKERNPDLDLDEIQQNPNVPDDVKAMLKESVLTLDT 413
            :::..||   ||:|:      ..|.|.|. ||:..:.:.::.::...|.|...|  ..:..|..|
  Rat    87 EIMSSDKQLIKMEKKEEEENGERPRKRKE-KEKEKEKEREKDKEKATVSDSAAA--SAAGTTPAT 148

  Fly   414 GDLATDEADFP-----NEDAMSLQSPANLKTKQELLEYID----DGTEDDDEEED-------FKR 462
            ...|......|     :|:.:|.....||:..:.||:::.    :..:|.|.|:|       .||
  Rat   149 SPPAVTSPAVPTTTTSSEEQVSEPKKWNLRRNRPLLDFVSMEELNDMDDYDSEDDNDWRPTVVKR 213

  Fly   463 R----KQKRRYDADYDDDWLASKRKTNSRNNRGRSPRTKDDRSISPASSTSSTSRGARRGKASGT 523
            :    .||...|.|.:||...........|:.|     .|:...||||..     |.::.|:...
  Rat   214 KGRSASQKEGSDGDNEDDDDEGSGSEEDENDEG-----NDEDHSSPASEA-----GGKKKKSKVL 268

  Fly   524 PRKTPARRK--KDSITTSPAVSS 544
            .|.:....:  .||:|.|.:.|:
  Rat   269 SRNSADDEELTNDSLTLSQSKSN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
Phf14XP_006236166.1 PHD1_PHF14 313..369 CDD:277036
ePHD_PHF14 377..490 CDD:277144
PHD2_PHF14 719..768 CDD:277037
PHD3_PHF14 862..920 CDD:277038
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.