DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and MLLT6

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_005928.2 Gene:MLLT6 / 4302 HGNCID:7138 Length:1093 Species:Homo sapiens


Alignment Length:230 Identity:47/230 - (20%)
Similarity:88/230 - (38%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 NSRNNRGRSPRTKDDRSISPASSTSSTSRGARRGKASGTPRKTPARRKKD---SITTSPAVSSAA 546
            :.|.:|..||.|:.::      ..:...||.::.:......|...:::.:   ||.|.|.|   .
Human   214 SGRRSRSASPSTQQEK------HPTHHERGQKKSRKDKERLKQKHKKRPESPPSILTPPVV---P 269

  Fly   547 TAVKTPTSAVVAGTTSIATTTTPPADGGGDAKKERQSLQFMQQSRKFEGKIPKLSQTSAATGGAT 611
            ||.|..:||..:.....:|..|      .::.:|.:..:....|...:||  |||.....:...:
Human   270 TADKVSSSASSSSHHEASTQET------SESSRESKGKKSSSHSLSHKGK--KLSSGKGVSSFTS 326

  Fly   612 AAAEASTSKSSQGQQQQIVYVNMLPAANTLNGIP--------QQQQQQQYASTDGNVYQLQNEIL 668
            |::.:|:|.||.|...|       ||.::|...|        :|.::.:|:..            
Human   327 ASSSSSSSSSSSGGPFQ-------PAVSSLQSSPDFSAFPKLEQPEEDKYSKP------------ 372

  Fly   669 CDANGHAVTAATASYQTTASSPQQQQQQQQQQQNV 703
                    ||...|...:.|:|:..:....:|:.|
Human   373 --------TAPAPSAPPSPSAPEPPKADLFEQKVV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
MLLT6NP_005928.2 PHD_AF10_AF17 7..54 CDD:277049
ePHD_AF17 61..185 CDD:277179
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..500 47/230 (20%)
Leucine-zipper 729..764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 775..871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1060..1093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.