DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and KDM4E

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001155102.1 Gene:KDM4E / 390245 HGNCID:37098 Length:506 Species:Homo sapiens


Alignment Length:335 Identity:187/335 - (55%)
Similarity:242/335 - (72%) Gaps:5/335 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKVFRPTWEEFKDFPKYVAYMESQGAHKAGLAKVVPPPEWVPRRSGYADLDALNVTIPAPICQVV 73
            |..|.||.|||.||..|||||||||||:||||||:||.||..|:. |.|::  ::.|..|:.||.
Human    15 IMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQM-YDDIE--DILIATPLQQVT 76

  Fly    74 TGKQGYYQQINIQKKPLTVKQFSELASTERYATPKHFDFEDLERKYWKNITYVAPIYGADVSGSI 138
            :|:.|.:.|.:.:||.:.|.|:..||::::|.||.|.:|.|||::|||:.....||||||:|||:
Human    77 SGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQRYWKSHPGNPPIYGADISGSL 141

  Fly   139 TDTDQDSWNINRLGTILDYVNKDYNIQIDGVNTAYLYFGMWKTTFAWHTEDMDLYSINYLHFGAP 203
            .:.....||:..||||||.:.::..:.|:||||.|||||||||||||||||||||||||||||.|
Human   142 FEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEP 206

  Fly   204 KTWYVVPPECGRKLEKVANQYFPASYKNCNAYLRHKMTLISPQILKQHDVPVSKITQEAGEIMIT 268
            |||||||||.|:.||::|.:.||...:.|.|:||||:.||||.:||::.:|.:.:||||||.|:|
Human   207 KTWYVVPPEHGQHLERLARELFPDISRGCEAFLRHKVALISPTVLKENGIPFNCMTQEAGEFMVT 271

  Fly   269 FPFGYHAGFNHGFNCAESTNFAMERWIEYGKRAVQCTCSNDMVKISMDTFVKRFQSDRYDLWMEG 333
            ||:||||||||||||||:.|||..|||:|||.|.||:|....|..|||.||:..|.:.|:||...
Human   272 FPYGYHAGFNHGFNCAEAINFATPRWIDYGKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHR 336

  Fly   334 RDVG--RHPE 341
            :|:.  .|.|
Human   337 QDLAIVEHTE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526 25/32 (78%)
JmjC 173..289 CDD:202224 82/115 (71%)
KDM4ENP_001155102.1 JmjN 16..50 CDD:280526 25/33 (76%)
JmjC 176..292 CDD:202224 82/115 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 432..473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2814
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000582
OrthoInspector 1 1.000 - - mtm8529
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.