DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and seq

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster


Alignment Length:125 Identity:122/125 - (97%)
Similarity:123/125 - (98%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 MQQSRKFEGKIPKLSQTSAATGGATAAAEASTSKSSQGQQQQIVYVNMLPAANTLNGIPQQQQQQ 651
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MQQSRKFEGKIPKLSQTSAATGGATAAAEASTSKSSQGQQQQIVYVNMLPAANTLNGIPQQQQQQ 65

  Fly   652 QYASTDGNVYQLQNEILCDANGHAVTAATASYQTTASSPQQQQQQQQQQQNVATSVAATI 711
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||..:
  Fly    66 QYASTDGNVYQLQNEILCDANGHAVTAATASYQTTASSPQQQQQQQQQQQNVATSVADNV 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.