DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and lid

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster


Alignment Length:309 Identity:102/309 - (33%)
Similarity:149/309 - (48%) Gaps:55/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VPPPEWVPRRSGYADLDALNVTIPAPICQVVTGKQ---GYYQQINIQKKPLTVKQFSELA---ST 101
            :|..||:               .|..:.:.|:..|   |:.|    .::..|::||.::|   ..
  Fly   485 IPKGEWL---------------CPRCVVEEVSKPQEAFGFEQ----AEREYTLQQFGQMADQFKQ 530

  Fly   102 ERYATPKHF-DFEDLERKYWKNITY----VAPIYGADV------SGSITDT-------DQD---- 144
            |.:..|.|. ..|.:||::|:.::.    |...||||:      ||..|.:       ||:    
  Fly   531 EYFRKPVHLVPTEMVEREFWRIVSSIDEDVTVEYGADLHTMDHGSGFPTKSSLYLLPGDQEYAES 595

  Fly   145 SWNINRLGTILDYVNKDYNIQIDGVNTAYLYFGMWKTTFAWHTEDMDLYSINYLHFGAPKTWYVV 209
            |||:|.|..:.|.:....|..|.|:|..::|.||....|.||.||...|||||||:|.|||||.|
  Fly   596 SWNLNNLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGV 660

  Fly   210 PPECGRKLEKVANQYFPASYKNCNAYLRHKMTLISPQILKQHDVPVSKITQEAGEIMITFPFGYH 274
            |..|..:.|:...|..|..:.:....|...:|:::|.||..:.|||.:..|.|||.:||||..||
  Fly   661 PGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYH 725

  Fly   275 AGFNHGFNCAESTNFAMERWIEYGKRAVQ--------CTCSNDMVKISM 315
            ||||.|:|.||:.|||...|::.|:..|.        |..|:|.:...|
  Fly   726 AGFNQGYNFAEAVNFAPADWLKMGRECVNHYSMLRRFCVFSHDELVCKM 774

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity