DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and jade3

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_970614.2 Gene:jade3 / 322209 ZFINID:ZDB-GENE-030131-928 Length:795 Species:Danio rerio


Alignment Length:193 Identity:41/193 - (21%)
Similarity:68/193 - (35%) Gaps:63/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 RGRSPRTKDDR-SISPASSTSSTSRGARRGKASGTPRKTPARRKKDSITTSPAVSSAATAVKTPT 553
            |.|:|.:.|.. :.||::|.||...|::.|..:...:|.....:||.|          :|:|.|.
Zfish     3 RLRTPSSSDSSDNESPSTSFSSNKYGSKPGTPASAQKKPAEVFRKDLI----------SAMKLPD 57

  Fly   554 SAVVA-----------------GTTSIATTTTPPADGGGDAKKERQSLQFMQQSRKFEGKIPKLS 601
            |..::                 |...:|:..|.|........::.:.:.| .:.||:   |...|
Zfish    58 SHHISSEDYYLLADTWKQEWEKGVQVLASPDTIPQPSVRIITEKPKEVLF-SKPRKY---IQCWS 118

  Fly   602 QTSAATGGATAAAEASTSKSSQGQQQQIVYVNMLPAANTLNGIPQQQQQQQYASTDGNVYQLQ 664
            |.|..||                      |||:...|..:         .:|...|.::|.||
Zfish   119 QDSTETG----------------------YVNIKELAEAM---------CRYDLDDMDLYWLQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
jade3NP_970614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 11/37 (30%)
EPL1 <89..178 CDD:287484 20/97 (21%)
COG5141 139..555 CDD:227470 5/12 (42%)
PHD_JADE3 203..252 CDD:277151
ePHD_JADE3 256..366 CDD:277176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 630..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..687
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 714..795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.