DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and Brd1

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_006242256.1 Gene:Brd1 / 315210 RGDID:1311855 Length:1189 Species:Rattus norvegicus


Alignment Length:272 Identity:54/272 - (19%)
Similarity:85/272 - (31%) Gaps:68/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 FQSDRYDLWMEGRDVGRHPEDP--------PNAVLSAAPLPP-----HLDVLLCDKKMKKQCNPT 373
            |.::.:....:...|..||.:|        |.|..||...|.     ...||.|  |.|....|.
  Rat   833 FDNESHSTCTQSALVSGHPPEPTLASSGDVPAAAASAVAEPSSDVNRRTSVLFC--KSKSVSPPK 895

  Fly   374 KAKSFKERNPDLDLDEIQQNPNVPD-DVKAMLKESVLTLDTGDLATDEADFPNEDAMSLQSPANL 437
            .||:            .:..|..|. ..|..|...:..|:|                 |..|...
  Rat   896 SAKN------------TETQPTSPQLGTKTFLSVVLPRLET-----------------LLQPRKR 931

  Fly   438 KTKQELLEYIDDGTEDDDEEEDFKRRKQKRRYDADYDDDW--LASKRKTNSRNNRGRSPRTK--D 498
            ..          .|..|.|.|:   ....:|.|....:.:  ..|:::..|...|..:||.:  .
  Rat   932 SR----------STCGDSEVEE---ESPGKRLDTGLTNGFGGTRSEQEPGSGPGRKAAPRRRCAS 983

  Fly   499 DRSI----SPASSTSSTSRGARRGKASGTPRKTPARRKK--DSITTSPAVSSAATAVKTPTSAVV 557
            :.||    ||...:|.::....|||.:...|.|...|.:  ..|.......:|..|.:...:::.
  Rat   984 ESSICSSNSPLCDSSFSTPKCGRGKPALVRRHTLEDRSELISCIENGNYAKAARIAAEVGQNSMW 1048

  Fly   558 AGTTSIATTTTP 569
            ..|.:.|:...|
  Rat  1049 ISTDAAASVLEP 1060

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
Brd1XP_006242256.1 EPL1 47..196 CDD:287484
PHD_BRPF2 214..267 CDD:277147
ePHD_BRPF2 271..388 CDD:277172
Bromo_brd1_like 566..663 CDD:99944
BR140_related 1058..1173 CDD:99900 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.