DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and Jade2

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_038941852.1 Gene:Jade2 / 303113 RGDID:1309152 Length:901 Species:Rattus norvegicus


Alignment Length:294 Identity:72/294 - (24%)
Similarity:102/294 - (34%) Gaps:88/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DKKMK-----KQCNPTKAKSFKERNPDLDLDEIQQNPNVPDD---VKAMLKESVLTLDTGDLATD 419
            |.|.|     |..:|.|.:..| ..|:..|.::..:.:.|.|   ..:.|.:|| .:...|:|..
  Rat   602 DSKRKGREGPKGSSPEKKEKMK-AGPESVLGQLGLSTSFPIDGTFFNSWLAQSV-QITAEDMAMS 664

  Fly   420 EADFPNEDAMSLQS-----PANLKTKQELLEYIDDGTEDDDEEE--DFKRRKQKRRYDADYDDDW 477
            |        .||.|     ||.....:|||:         |||.  .|.|....|..|.      
  Rat   665 E--------WSLNSGHREDPAPGLLSEELLQ---------DEETLLSFMRDPSLRPGDP------ 706

  Fly   478 LASKRKTNSRNNRGRS--------PRTKDDRSISPASSTSSTSRGARRGKAS-GTPRKTPARRKK 533
                    :|..|||:        |..:|..|........:....|:.||.: |.|.:.|.||..
  Rat   707 --------ARKARGRTRLPAKKKPPPLQDGPSARTTPEKPAKKAWAQDGKGTQGPPARKPPRRTS 763

  Fly   534 DSITTSPAVSSA---ATAVKTPTSAVVAGTTSIATTTTPPADG------G--------GDAKKER 581
            ..:.:|||....   ||....||.|     :.|...|.|.|..      |        |..:..|
  Rat   764 SHLPSSPAAGDCPVPATLESPPTLA-----SEILDETVPAASDLNVQVPGPTVSPKPLGRLRPPR 823

  Fly   582 QSLQFMQQSRKFEGKIPKLSQTSAATGGATAAAE 615
            :    |:.|||..|     :::.|.||..:..||
  Rat   824 E----MKVSRKSPG-----ARSDAGTGLPSTVAE 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
Jade2XP_038941852.1 EPL1 82..247 CDD:402235
COG5141 209..>578 CDD:227470
PHD_SF 326..436 CDD:419867
PHA03247 <676..852 CDD:223021 52/210 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.