DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and Kdm4c

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001100133.3 Gene:Kdm4c / 298144 RGDID:1307528 Length:1053 Species:Rattus norvegicus


Alignment Length:534 Identity:256/534 - (47%)
Similarity:330/534 - (61%) Gaps:103/534 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIKVFRPTWEEFKDFPKYVAYMESQGAHKAGLAKVVPPPEWVPRRSGYADLDALNVTIPAPICQV 72
            :|..|||:.|||::|.||:|||||:|||:||||||:||.||.||:. |.|:|  |:.|||||.|:
  Rat    15 KIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC-YDDID--NLLIPAPIQQM 76

  Fly    73 VTGKQGYYQQINIQKKPLTVKQFSELASTERYATPKHFDFEDLERKYWKNITYVAPIYGADVSGS 137
            |||:.|.:.|.||||||:|||:|.:||::.:|.||::.|:||||||||||:|:||||||||::||
  Rat    77 VTGQSGLFTQYNIQKKPMTVKEFRQLANSSKYCTPRYLDYEDLERKYWKNLTFVAPIYGADINGS 141

  Fly   138 ITDTDQDSWNINRLGTILDYVNKDYNIQIDGVNTAYLYFGMWKTTFAWHTEDMDLYSINYLHFGA 202
            |.|...|.|||.||.|:||.|.::..|.|:||||.|||||||||||||||||||||||||||||.
  Rat   142 IYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGE 206

  Fly   203 PKTWYVVPPECGRKLEKVANQYFPASYKNCNAYLRHKMTLISPQILKQHDVPVSKITQEAGEIMI 267
            ||:||.:|||.|::||::|..:||:|.:.|:|:||||||||||.:||::.:|..||||||||.||
  Rat   207 PKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMI 271

  Fly   268 TFPFGYHAGFNHGFNCAESTNFAMERWIEYGKRAVQCTCSNDMVKISMDTFVKRFQSDRYDLWME 332
            |||:|||||||||||||||||||..|||:|||.|..|||.|||||||||.|||:||.|||.:|.:
  Rat   272 TFPYGYHAGFNHGFNCAESTNFATVRWIDYGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQIWKQ 336

  Fly   333 GRDVGR--H----PEDPPNA------------------------------------------VLS 349
            |:|:..  |    ||..|..                                          |.|
  Rat   337 GKDIYTIDHTKPTPESTPEVKTWLQRRKKLRKAPKSLQGNKSLSKRPKAEEDEEFAEFIGEEVSS 401

  Fly   350 AAPLPPHLDVLLCDKKMKKQCNPTKAKSFKERNPDLDLDEIQQNPNVPDDV----KAMLKESVLT 410
            .|..|.||.|  .:|..|.:.....|.|.||.:.    ..||.:.::.:|.    |:.:..||: 
  Rat   402 PAVCPRHLKV--TEKPEKFKLANIGASSEKEASD----TRIQVDQSLTNDTKLSGKSCINSSVI- 459

  Fly   411 LDTGDLATDEADFPNEDAMSLQSPANLKTKQELLEY----------------------------- 446
                    ||....|:.|.::.||:.||...:|:.:                             
  Rat   460 --------DEIQPENDTANAVTSPSTLKKASDLIPFSHGHITGKESRLLKILQLESPKIPSSLAE 516

  Fly   447 ----IDDGTEDDDE 456
                :.:|.|:|:|
  Rat   517 SNRVLTEGEENDEE 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526 23/32 (72%)
JmjC 173..289 CDD:202224 87/115 (76%)
Kdm4cNP_001100133.3 JmjN 16..57 CDD:301729 28/40 (70%)
JmjC 177..293 CDD:202224 87/115 (76%)
PHD_SF 642..743 CDD:304600
PHD_SF 752..861 CDD:304600
TUDOR 874..930 CDD:197660
TUDOR 932..987 CDD:197660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339148
Domainoid 1 1.000 210 1.000 Domainoid score I2717
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000582
OrthoInspector 1 1.000 - - mtm9003
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X490
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.