| Sequence 1: | NP_001260942.1 | Gene: | Kdm4B / 318918 | FlyBaseID: | FBgn0053182 | Length: | 717 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001074784.1 | Gene: | Brpf3 / 268936 | MGIID: | 2146836 | Length: | 1204 | Species: | Mus musculus |
| Alignment Length: | 252 | Identity: | 51/252 - (20%) |
|---|---|---|---|
| Similarity: | 86/252 - (34%) | Gaps: | 77/252 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 340 PEDPPNAVLSAAPLPPHLDVLLCDKKMKKQCNPTKAKSFKERNPDLDLDEIQQNPNVPDDVKAML 404
Fly 405 KESVLTLDT-------GDLATDEADFPNEDA-----------------------MSLQ-SPANLK 438
Fly 439 TKQELLEYIDDGTEDD------DEEEDFKRRKQKRRYDADYDDDWLASKRKTNSRNNRGRSPRTK 497
Fly 498 DDRSI-------SPASSTSSTSRGARRGKA----SGTPRKTPARRKKDSITTSPAVS 543 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kdm4B | NP_001260942.1 | JmjN | 11..44 | CDD:280526 | |
| JmjC | 173..289 | CDD:202224 | |||
| Brpf3 | NP_001074784.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 76..127 | ||||
| COG5141 | 117..>603 | CDD:227470 | |||
| ePHD_BRPF3 | 269..386 | CDD:277173 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 393..464 | ||||
| Bromo_brd1_like | 592..689 | CDD:99944 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 778..879 | 11/58 (19%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 903..1015 | 22/131 (17%) | |||
| BR140_related | 1073..1188 | CDD:99900 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5141 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||