DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4B and phf-14

DIOPT Version :9

Sequence 1:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_507508.2 Gene:phf-14 / 180169 WormBaseID:WBGene00013339 Length:599 Species:Caenorhabditis elegans


Alignment Length:231 Identity:48/231 - (20%)
Similarity:86/231 - (37%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 VKISMDTFVKRFQSDRYDLWMEGRDVGRHPEDPPNAVLSAAPLPPHLDVLLCDKKMKKQ---CNP 372
            :|::..:.|....|..|..:|:.||....||:                    ::|::|.   ...
 Worm   395 IKLNSGSHVPIGFSKEYIDFMQIRDSQIIPEE--------------------EEKLRKSRELLAE 439

  Fly   373 TKAKSFKERNPDLDLDEIQQNPNVPDDVKAMLKE--SVLTLDTGDLATDEADFPNEDAMSLQSPA 435
            |||...|:.:....::....|..:.:.....:::  .:||...||.....:||.|..:.|..|||
 Worm   440 TKANQEKKSSQKHLVERFSANEELIEQKLTSIEKLHQLLTELGGDSGLLLSDFNNRQSCSRSSPA 504

  Fly   436 NLKTKQELLEYIDDGTEDDDEEEDFKRRKQKRRYDADYDDDWLASK-RKTNSRNNRG-----RSP 494
            .:..|:  :.|.........|:.   ::.|.......|....|:.. .:...|||.|     .:.
 Worm   505 IIAPKK--MNYTCVVCRKSTEQH---KQTQCDECHKSYHIGCLSPPLTRLPKRNNFGWICHECNE 564

  Fly   495 RTKDDRSISPASSTSSTSRGARRGKASGTPRKTPAR 530
            .:..::.|.|.:| .||:|..|       .|:.|||
 Worm   565 SSDSEQEIIPEAS-ESTTRSVR-------SRRPPAR 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
phf-14NP_507508.2 PHD1_PHF14 107..155 CDD:277036
PHD_SF 165..282 CDD:304600
PHD_SF 515..562 CDD:304600 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.