DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl15 and mthl7

DIOPT Version :9

Sequence 1:NP_723538.3 Gene:mthl15 / 318914 FlyBaseID:FBgn0051720 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:528 Identity:125/528 - (23%)
Similarity:203/528 - (38%) Gaps:126/528 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LIWKDGTNS-LPSSKF-------CIEAIHDS---DDADL--------------DRGALPEQKFLV 247
            ||:.:.:|: :|...:       .||..:||   ||.::              |....|.:|.| 
  Fly    14 LIFTNNSNADIPGCNYYDTVDISYIERQNDSYLYDDIEIPASLTGYYEFRQFGDGSITPIEKHL- 77

  Fly   248 RACQEMKICQKIPCIRRCCAEGEMYAKGNFSTYCKIDGTDFK-FEGFQNLNINANFSKP------ 305
            |||    :|...||||.||......|.|......|.:...|| :..|..:::.|.....      
  Fly    78 RAC----VCSVRPCIRICCPAKNFLANGKCDDGLKEELARFKPYIYFTYMDLQARVPLTDMAIIR 138

  Fly   306 ------------SDF---------------GIVHGLQCPKFRLDPDNFPDDSHTINPSNGSLIIH 343
                        |||               |::...|..||.:..|.|      :...:..|..|
  Fly   139 DEFFDCDEMIYISDFNYFLEEVSIQIFNKCGLIVWFQDGKFWVTVDLF------MEKQDYCLYRH 197

  Fly   344 NTFKTYTNTQY-----CVERVRPNQ---KLYTFLCFDNKVVTGDRIRFKMYPIGLLISCCFYALT 400
            |....:..:.:     |...:.|..   .:.|.:||                          .||
  Fly   198 NFDSDFPKSMWIIRHRCTSHISPGSLEILIITMICF--------------------------VLT 236

  Fly   401 LIVYISIAKLRNLPGKILICLVSSLFAAYLGIALGQLRPTSNDDICFLSGFFVYFCLMAAFSWMN 465
            :.||:.|.||||:.||.::|.:.|.|...|.:.|..|...:.  ||..:|:..:|..||:..|::
  Fly   237 IAVYLYIKKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNG--ICSPAGYSSHFFRMASNLWLS 299

  Fly   466 ITSFDIWKTFGSTKLKSCEKSDLRRQFIWYSCYGWGLPTLLTG---ITIAFTKSDILPDAVRPNF 527
            :.|:..||.     |.|..:.|...:|:.|:.:.|....::||   |.....::|.......|..
  Fly   300 VISYHTWKV-----LTSLNRVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLV 359

  Fly   528 GHGRCWFTYDSFGSASLLFFSGPVGILFIINLVLFVLTMKYCNKVKNEIYKMQSLNSDKPVLKRR 592
            |..||  :...:..:..::.|||...|...|:.:|.||..|..|||..|.|.  .|.::..:...
  Fly   360 GFIRC--SVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKVKGGINKF--TNEEEGRINCI 420

  Fly   593 FFQDKTRFVMNTKLCFVMGITWLLEIVSILFYDHKKTFFW----TISDSFNVLLGIFVFIIFVFK 653
            .|..:| ::...:|..|||:||:..::.   |..:...||    .||:.|:...||.:|::.|.|
  Fly   421 NFDSQT-YLQFLRLSIVMGLTWIFNVIP---YSARLHIFWEWVGIISEYFHSAFGIVLFVLLVLK 481

  Fly   654 RRIYNEIM 661
            |..:..:|
  Fly   482 RSTWTLMM 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl15NP_723538.3 Mth_Ecto <247..355 CDD:299804 29/146 (20%)
7tm_4 385..646 CDD:304433 72/267 (27%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 39/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4416
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5395
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.