DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl15 and LOC108181087

DIOPT Version :9

Sequence 1:NP_723538.3 Gene:mthl15 / 318914 FlyBaseID:FBgn0051720 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_021329169.1 Gene:LOC108181087 / 108181087 -ID:- Length:166 Species:Danio rerio


Alignment Length:204 Identity:47/204 - (23%)
Similarity:77/204 - (37%) Gaps:49/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 VYFCLMAAFSWMNITSFDIWKTFGSTKLKSCEKSDLRRQFIWYSCYGWGLPTLLTGITIAFTKSD 517
            ::...|||||||.:....:|....|..|..      .|...:|...|||||.|:..||:|.....
Zfish     1 MHLFFMAAFSWMLVEGLLLWSKVVSVNLSE------DRHMKYYYLIGWGLPVLIVTITLASASGK 59

  Fly   518 ILPDAVRPNFGHGRCWFTYDSFGSASLLFFSGPVGILFIINLVLF--VLTMKYCNKVKNEIYKMQ 580
            ...|        |.||.   |..:..:..|:|||..:.::|:::.  |:.:......:..:  |.
Zfish    60 YTAD--------GHCWL---SVQNGVIWGFAGPVIFIIMVNIMILTRVVVITIATAKRRSL--MM 111

  Fly   581 SLNSDKPVLKRRFFQDKTRFVMNTKLCF--VMGITWLLEIVSILFYDHKKTFFWTISDSFNVLLG 643
            :||:.    ......::.|..:...|..  ::|:|||.                      .||:.
Zfish   112 ALNNS----PEEQISEQIRAAVKAVLVLLPILGLTWLC----------------------GVLVP 150

  Fly   644 IFVFIIFVF 652
            ..|.|.:||
Zfish   151 FSVVIAYVF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl15NP_723538.3 Mth_Ecto <247..355 CDD:299804
7tm_4 385..646 CDD:304433 43/196 (22%)
LOC108181087XP_021329169.1 7tm_GPCRs <1..166 CDD:333717 47/204 (23%)
TM helix 4 36..52 CDD:320095 7/15 (47%)
TM helix 5 71..94 CDD:320095 5/22 (23%)
TM helix 6 126..151 CDD:320095 8/46 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.