Sequence 1: | NP_723538.3 | Gene: | mthl15 / 318914 | FlyBaseID: | FBgn0051720 | Length: | 718 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021329169.1 | Gene: | LOC108181087 / 108181087 | -ID: | - | Length: | 166 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 47/204 - (23%) |
---|---|---|---|
Similarity: | 77/204 - (37%) | Gaps: | 49/204 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 453 VYFCLMAAFSWMNITSFDIWKTFGSTKLKSCEKSDLRRQFIWYSCYGWGLPTLLTGITIAFTKSD 517
Fly 518 ILPDAVRPNFGHGRCWFTYDSFGSASLLFFSGPVGILFIINLVLF--VLTMKYCNKVKNEIYKMQ 580
Fly 581 SLNSDKPVLKRRFFQDKTRFVMNTKLCF--VMGITWLLEIVSILFYDHKKTFFWTISDSFNVLLG 643
Fly 644 IFVFIIFVF 652 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mthl15 | NP_723538.3 | Mth_Ecto | <247..355 | CDD:299804 | |
7tm_4 | 385..646 | CDD:304433 | 43/196 (22%) | ||
LOC108181087 | XP_021329169.1 | 7tm_GPCRs | <1..166 | CDD:333717 | 47/204 (23%) |
TM helix 4 | 36..52 | CDD:320095 | 7/15 (47%) | ||
TM helix 5 | 71..94 | CDD:320095 | 5/22 (23%) | ||
TM helix 6 | 126..151 | CDD:320095 | 8/46 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1153592at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |