DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33178 and Ptges

DIOPT Version :9

Sequence 1:NP_001285263.1 Gene:CG33178 / 318913 FlyBaseID:FBgn0053178 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_067594.1 Gene:Ptges / 59103 RGDID:62076 Length:153 Species:Rattus norvegicus


Alignment Length:132 Identity:49/132 - (37%)
Similarity:68/132 - (51%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MTSPGDMFTLEN-PVFCCYLFWSTVLVVKMLLMSLLTAVQRFRYKLLAIVPLALRRRIFPNQEDL 75
            |||.|  ..:|| .|...:|..||:||:||..::::|...|            ||::.|.|.||.
  Rat     1 MTSLG--LVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVR------------LRKKAFANPEDA 51

  Fly    76 FFK-NLEVQFDDPHVERVRRAHRNDMENILPYFIMSLIYISTNPNADVACILFRVASVARIIHTL 139
            ..: .|:....||.|||..||||||||.|.|:..:..:|....||..:|.|.|.|....|::||:
  Rat    52 LKRGGLQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTV 116

  Fly   140 VY 141
            .|
  Rat   117 AY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33178NP_001285263.1 MAPEG 29..171 CDD:395893 42/114 (37%)
PtgesNP_067594.1 MAPEG 17..147 CDD:395893 42/114 (37%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 74..78 3/3 (100%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 127..131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.