DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and plpp7

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001072544.1 Gene:plpp7 / 779999 XenbaseID:XB-GENE-977766 Length:269 Species:Xenopus tropicalis


Alignment Length:185 Identity:57/185 - (30%)
Similarity:99/185 - (53%) Gaps:14/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFIWLLSSKSLYQMQVNML 75
            |:..|:.:||...|..::.|.:...|...|.:.|:..|..|....:..:|..|:.:..::.:|:|
 Frog    83 LMAIDICLSKRLGVCANSTSSWGGARSMVRLIGITSHGFPWIGGTLLCLWKSSTLAGQEVLMNLL 147

  Fly    76 FGLILDVVIVAVLKALVRRRRPVASK----DMLTIGPDKFSFPSGHASRAFFVLLFFAKLYPLHI 136
            ..|:||::.||.::.|::||.|....    |.|.:  |.::||:||||||..|..||..    |:
 Frog   148 LALMLDILTVAGVQKLIKRRGPYEMTPGVLDYLVL--DVYAFPAGHASRATMVSKFFLN----HL 206

  Fly   137 IFLMP----VTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWISEET 187
            :..:|    :..||..|.:||:::.||:|.|:..|..||.::..:|.:||:|..|
 Frog   207 VLAIPLRILLVLWAFIVGVSRIMIGRHHISDVIVGFIIGYMQFNLVEVLWLSSGT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 48/163 (29%)
PgpB <49..182 CDD:223743 43/140 (31%)
plpp7NP_001072544.1 PAP2_containing_2_like 95..253 CDD:239485 48/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8297
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4732
OMA 1 1.010 - - QHG49210
OrthoDB 1 1.010 - - D1356295at2759
OrthoFinder 1 1.000 - - FOG0002759
OrthoInspector 1 1.000 - - otm49332
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3913
SonicParanoid 1 1.000 - - X1845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.