DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and Plpp6

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_083198.1 Gene:Plpp6 / 74411 MGIID:1921661 Length:292 Species:Mus musculus


Alignment Length:184 Identity:69/184 - (37%)
Similarity:106/184 - (57%) Gaps:10/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFIWLLSSKSLYQMQ 71
            ||:.||..|:.:||...|.....|.:.|:|...:.||||..||.|.:..:..:....|.:..::.
Mouse    99 ALRSLLAIDLWLSKKLGVCAGESSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVL 163

  Fly    72 VNMLFGLILDVVIVAVLKALVRRRRPVAS-KDM-LTIGPDKFSFPSGHASRAFFVLLFFAKLYPL 134
            :|:||.|:||:::|||:|.|||||||..: ||| .|:..|::|||||||:||..|..|...    
Mouse   164 MNLLFALLLDLLLVAVIKGLVRRRRPAHNQKDMFFTLSVDRYSFPSGHATRAALVSRFILN---- 224

  Fly   135 HIIFLMP----VTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWIS 184
            |::..:|    |..||..:.:||::|.||.:.|:..|..:|.::..||...|:|
Mouse   225 HLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 59/161 (37%)
PgpB <49..182 CDD:223743 51/138 (37%)
Plpp6NP_083198.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..86
PAP2_containing_2_like 115..273 CDD:239485 59/161 (37%)
PgpB <204..266 CDD:223743 23/65 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831543
Domainoid 1 1.000 84 1.000 Domainoid score I8261
eggNOG 1 0.900 - - E1_KOG4268
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45228
Inparanoid 1 1.050 113 1.000 Inparanoid score I4839
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1356295at2759
OrthoFinder 1 1.000 - - FOG0002759
OrthoInspector 1 1.000 - - otm44153
orthoMCL 1 0.900 - - OOG6_102653
Panther 1 1.100 - - LDO PTHR14969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3913
SonicParanoid 1 1.000 - - X1845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.