DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and LOC568758

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_697201.5 Gene:LOC568758 / 568758 -ID:- Length:282 Species:Danio rerio


Alignment Length:196 Identity:59/196 - (30%)
Similarity:104/196 - (53%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFIWLLSSKSLYQMQ 71
            |:..||..|:.:||...|.....|.:.|.|.....|.::..|:.|....:..:...|:.:..::.
Zfish    84 AVSSLLAIDICLSKRLGVCRHGSSSWGSSRSVVSLLALTGHGLTWVCGTLLCLCQSSTPAGQEVL 148

  Fly    72 VNMLFGLILDVVIVAVLKALVRRRRP--VASKDMLTIGPDKFSFPSGHASRAFFVLLFFAKLYPL 134
            :|:|.||:|||:.||.::.|||||.|  ::...:..:..|::|||:||||||..|..|...    
Zfish   149 INLLMGLVLDVLTVAGVQKLVRRRGPWDISPGLLDCVALDRYSFPAGHASRAALVSRFLLS---- 209

  Fly   135 HIIFLMP----VTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETAFSIVGFV 195
            |::..:|    :..||..|.:||::|.:|::.|:.||.|:|.|...::..:|:|.....:::...
Zfish   210 HLVLAVPLRVLLVLWAALVGLSRVLLGQHHLTDVAAGFALGFLHFSLMETVWLSSSACQTLISIG 274

  Fly   196 T 196
            |
Zfish   275 T 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 50/161 (31%)
PgpB <49..182 CDD:223743 44/138 (32%)
LOC568758XP_697201.5 PAP2_containing_2_like 100..258 CDD:239485 50/161 (31%)
PgpB <189..252 CDD:223743 25/66 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574581
Domainoid 1 1.000 79 1.000 Domainoid score I8611
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4887
OMA 1 1.010 - - QHG49210
OrthoDB 1 1.010 - - D1356295at2759
OrthoFinder 1 1.000 - - FOG0002759
OrthoInspector 1 1.000 - - otm24500
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.