DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and plpp6

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001315267.1 Gene:plpp6 / 553687 ZFINID:ZDB-GENE-040724-247 Length:288 Species:Danio rerio


Alignment Length:193 Identity:70/193 - (36%)
Similarity:105/193 - (54%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFIWLLSSKSLYQMQ 71
            ||..||..|:.:||...|.....|.:.|:|...:.:|:|..||.|.......::...|.:..::.
Zfish    97 ALSSLLAIDLWLSKRLGVCACEDSSWGSVRPLMKLIEVSGHGIPWLAGAAYCLYKSDSPAGQEVM 161

  Fly    72 VNMLFGLILDVVIVAVLKALVRRRRPVASK-DML-TIGPDKFSFPSGHASRAF----FVLLFFAK 130
            :|:|..|:||||:|.||||:||||||..:: ||. |...|.:|||||||:||.    |:|.....
Zfish   162 LNLLMALVLDVVLVGVLKAVVRRRRPAHNRMDMFATFSMDSYSFPSGHATRAAMCARFLLTHLVL 226

  Fly   131 LYPLHIIFLMPVTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETAFSIVG 193
            ..||.::.|:    ||..|..||::|.||.:.|:..|..:|..:..:|.:||:|.....|.:|
Zfish   227 AAPLRVLVLL----WATIVGFSRVLLGRHNVTDVAFGFFMGYWQYNLVEMLWLSPVMLQSAIG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 57/161 (35%)
PgpB <49..182 CDD:223743 51/138 (37%)
plpp6NP_001315267.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82
PAP2_containing_2_like 113..271 CDD:239485 57/161 (35%)
PgpB <202..265 CDD:223743 25/66 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574584
Domainoid 1 1.000 79 1.000 Domainoid score I8611
eggNOG 1 0.900 - - E1_KOG4268
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4887
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1356295at2759
OrthoFinder 1 1.000 - - FOG0002759
OrthoInspector 1 1.000 - - otm24500
orthoMCL 1 0.900 - - OOG6_102653
Panther 1 1.100 - - LDO PTHR14969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3913
SonicParanoid 1 1.000 - - X1845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.