DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and PLPP6

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_982278.3 Gene:PLPP6 / 403313 HGNCID:23682 Length:295 Species:Homo sapiens


Alignment Length:188 Identity:68/188 - (36%)
Similarity:108/188 - (57%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFIWLLSSKSLYQMQ 71
            ||:.||..|:.:||...|.....|.:.|:|...:.||||..||.|.:..:..:....|.:..::.
Human   102 ALRSLLAIDLWLSKKLGVCAGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSWAGREVL 166

  Fly    72 VNMLFGLILDVVIVAVLKALVRRRRPVASK-DM-LTIGPDKFSFPSGHASRAFFVLLFFAKLYPL 134
            :|:||.|:||:::||::|.|||||||..:: || :|:..||:|||||||:||..:..|...    
Human   167 MNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHATRAALMSRFILN---- 227

  Fly   135 HIIFLMP----VTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETA 188
            |::..:|    |..||..:.:||::|.||.:.|:..|..:|.::..||...|:|...|
Human   228 HLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 57/161 (35%)
PgpB <49..182 CDD:223743 49/138 (36%)
PLPP6NP_982278.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..90
PAP2_containing_2_like 118..276 CDD:239485 57/161 (35%)
PgpB <208..292 CDD:223743 28/82 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141593
Domainoid 1 1.000 82 1.000 Domainoid score I8434
eggNOG 1 0.900 - - E1_KOG4268
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45228
Inparanoid 1 1.050 112 1.000 Inparanoid score I4864
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1356295at2759
OrthoFinder 1 1.000 - - FOG0002759
OrthoInspector 1 1.000 - - otm42099
orthoMCL 1 0.900 - - OOG6_102653
Panther 1 1.100 - - LDO PTHR14969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3913
SonicParanoid 1 1.000 - - X1845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.