DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and Sgpp2

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001178740.1 Gene:Sgpp2 / 301543 RGDID:1565739 Length:354 Species:Rattus norvegicus


Alignment Length:134 Identity:33/134 - (24%)
Similarity:62/134 - (46%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ILDVVIVAVLKALVRRRR----PVASKDMLTIGPDKFSFPSGHASRA---FFVLLFFAK---LYP 133
            :|.:.|..|.|.:::..|    ||...:...|.  ::..||.||..|   .|.||....   .||
  Rat    81 VLVMYIGQVAKDILKWPRPSSPPVVKLEKRVIA--EYGMPSTHAMAATAISFTLLISTMDRYQYP 143

  Fly   134 LHIIFLMPVTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETAFSIVGFVTEE 198
            . |:.|:....::..|::|||....|.:||:..|.   ::.|:::.|.:    .|::::     :
  Rat   144 F-ILGLIMAVVFSTLVSLSRLYTGMHTVLDVLGGV---LITAVLIALTY----PAWTLI-----D 195

  Fly   199 TVDS 202
            ::||
  Rat   196 SLDS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 29/109 (27%)
PgpB <49..182 CDD:223743 30/112 (27%)
Sgpp2NP_001178740.1 PAP2_SPPase1 39..188 CDD:239482 30/112 (27%)
PgpB <40..191 CDD:223743 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.