DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and Plpp7

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001012349.1 Gene:Plpp7 / 296635 RGDID:1305821 Length:271 Species:Rattus norvegicus


Alignment Length:196 Identity:63/196 - (32%)
Similarity:104/196 - (53%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFIWLLSSKSLYQMQ 71
            |...||..|:.:||...|.....:.:.|.|...:.:.|:..||.|....|  :.|:.|.:|...:
  Rat    81 AFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITSHGIPWIGGTI--LCLVRSSTLAGQE 143

  Fly    72 V--NMLFGLILDVVIVAVLKALVRRRRPVASK----DMLTIGPDKFSFPSGHASRAFFVLLFFAK 130
            |  |:|..|:||::.||.::.|::||.|..:.    |.||:  |.::||:||||||..|..||..
  Rat   144 VLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLDYLTM--DIYAFPAGHASRAAMVSKFFLS 206

  Fly   131 LYPLHIIFLMP----VTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETAFSI 191
                |::..:|    :..||..|.:||:::.||:|.|:.:|..||..:..:|.|:|:|..|...:
  Rat   207 ----HLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDVISGFIIGYFQFRLVELVWMSSNTCQML 267

  Fly   192 V 192
            :
  Rat   268 I 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 52/165 (32%)
PgpB <49..182 CDD:223743 49/142 (35%)
Plpp7NP_001012349.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Interaction with MTOR. /evidence=ECO:0000250 70..91 4/9 (44%)
PAP2_containing_2_like 97..255 CDD:239485 52/165 (32%)
PgpB <123..249 CDD:223743 47/133 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335282
Domainoid 1 1.000 84 1.000 Domainoid score I8064
eggNOG 1 0.900 - - E1_KOG4268
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4755
OMA 1 1.010 - - QHG49210
OrthoDB 1 1.010 - - D1356295at2759
OrthoFinder 1 1.000 - - FOG0002759
OrthoInspector 1 1.000 - - otm46249
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1845
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.