DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31717 and sgpp2

DIOPT Version :9

Sequence 1:NP_001260317.1 Gene:CG31717 / 318911 FlyBaseID:FBgn0051717 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001373215.1 Gene:sgpp2 / 100330698 ZFINID:ZDB-GENE-120221-2 Length:415 Species:Danio rerio


Alignment Length:185 Identity:48/185 - (25%)
Similarity:79/185 - (42%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LEKDVQVS----KHFVVAVSNLSFFKSLRIHSRFLEISCDGIAWFVSWIAFI----WLLSSKSLY 68
            |:.|.:|.    .|:|  |.|..|:        ||.::...:...:.:|.|:    |.| ...|.
Zfish    77 LQNDNKVEGHPRPHYV--VKNWLFY--------FLFVTSATLGHEIFYITFLPCIHWNL-DPFLC 130

  Fly    69 QMQVNMLFGLILDVVIVAVLKALVRRRRPVASK--DMLTIGPDKFSFPSGHASRA---FFVLLFF 128
            :..|||   .::.:.|..|:|.:::..||.:..  .:.|....::..||.||..|   .|.||..
Zfish   131 RRLVNM---WVVVMYIGQVMKDVLKLPRPPSPPVVKLETRVDAEYGMPSTHAMAATAISFTLLLS 192

  Fly   129 AK---LYPLHIIFLMPVTAWAVSVAISRLILQRHYILDICAGAAIGVLEALIVGL 180
            |:   .:|..:...:.| ..:|.|.:|||....|..||:..|.||   .|.|:.:
Zfish   193 AEERVQFPFELGLAVAV-LMSVLVCLSRLYTGMHSALDVICGVAI---SAFIIAV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31717NP_001260317.1 PAP2_containing_2_like 23..179 CDD:239485 44/167 (26%)
PgpB <49..182 CDD:223743 38/144 (26%)
sgpp2NP_001373215.1 PAP2_SPPase1 96..243 CDD:239482 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.