DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43672 and Abca12

DIOPT Version :10

Sequence 1:NP_788912.3 Gene:CG43672 / 318910 FlyBaseID:FBgn0263747 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_780419.2 Gene:Abca12 / 74591 MGIID:2676312 Length:2595 Species:Mus musculus


Alignment Length:76 Identity:19/76 - (25%)
Similarity:33/76 - (43%) Gaps:17/76 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IMESQKGDLYEGESVDQLAKRMIEH-----------LLKWGVTDAFND-KQIYTILEKAESTLN- 53
            ::::.:.|..|.|::..||...|:.           |....:..:|.| ||.....:..:|||| 
Mouse    22 VLQTTEKDKEEKENLCLLALNFIQQQHNLTLSQHYKLTNDKIKGSFRDMKQRLMSTKTCKSTLNG 86

  Fly    54 ----PLPAMLQ 60
                |.|::||
Mouse    87 SQSEPAPSLLQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43672NP_788912.3 rim_protein <266..>732 CDD:130324
ABC_subfamily_A 519..737 CDD:213230
P-loop containing Nucleoside Triphosphate Hydrolases 1330..1517 CDD:476819
Abca12NP_780419.2 rim_protein 7..>86 CDD:130324 14/63 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..143
rim_protein 749..2569 CDD:130324
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1672..1703
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2575..2595
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.