DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31715 and NAS6

DIOPT Version :10

Sequence 1:NP_723568.1 Gene:CG31715 / 318909 FlyBaseID:FBgn0051715 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_011748.3 Gene:NAS6 / 853147 SGDID:S000003464 Length:228 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:39/132 - (29%)
Similarity:63/132 - (47%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAISNEDII---------WTIKNGEFDAVQDAFQNDAQKVNEEIKGRF---PVHYAADFGQLNV 53
            ::.|:|:.:.         |      |:..|...:|.|   :..||.:|   |:|.||..|.|.:
Yeast   100 LNKITNQGVTCLHLAVGKKW------FEVSQFLIENGA---SVRIKDKFNQIPLHRAASVGSLKL 155

  Fly    54 LEFLISLG-ADINRKDKHGITPILAAIWEGHTSCVELLL-KMGADKNGSTPDGQSYLEAAEKDEI 116
            :|.|..|| :.:|.:||.|.||:..|:.|||.....||: |.||:.:.....|....:.|..:::
Yeast   156 IELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQV 220

  Fly   117 KK 118
            ||
Yeast   221 KK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31715NP_723568.1 ANKYR <6..>120 CDD:440430 38/127 (30%)
ANK repeat 9..36 CDD:293786 5/35 (14%)
ANK repeat 38..68 CDD:293786 12/33 (36%)
ANK repeat 70..98 CDD:293786 12/28 (43%)
NAS6NP_011748.3 ANK repeat 1..33 CDD:293786
ANKYR 3..226 CDD:440430 39/132 (30%)
ANK repeat 35..69 CDD:293786
ANK repeat 71..104 CDD:293786 0/3 (0%)
ANK repeat 107..137 CDD:293786 6/38 (16%)
ANK repeat 139..171 CDD:293786 12/31 (39%)
ANK repeat 173..205 CDD:293786 12/31 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.