DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31715 and ANKRD29

DIOPT Version :10

Sequence 1:NP_723568.1 Gene:CG31715 / 318909 FlyBaseID:FBgn0051715 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_775776.2 Gene:ANKRD29 / 147463 HGNCID:27110 Length:301 Species:Homo sapiens


Alignment Length:109 Identity:34/109 - (31%)
Similarity:57/109 - (52%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQLNVLEFLISLGADINRKDKHGITPILAAIW 80
            |....|:...::.|...::...|...:..||..|.|:|:..|::.||.:|:..:.|..|:..|..
Human   123 GHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTAPLWIASQ 187

  Fly    81 EGHTSCVELLLKMGADKNGSTPDG-QSYLEAAEK---DEIKKLL 120
            .||:..|.::|..|||::.:..|| .:.|:||.|   |.||:||
Human   188 MGHSEVVRVMLLRGADRDAARNDGTTALLKAANKGYNDVIKELL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31715NP_723568.1 ANKYR <6..>120 CDD:440430 32/107 (30%)
ANK repeat 9..36 CDD:293786 3/19 (16%)
ANK repeat 38..68 CDD:293786 10/29 (34%)
ANK repeat 70..98 CDD:293786 10/27 (37%)
ANKRD29NP_775776.2 ANK repeat 9..43 CDD:293786
ANK 1 11..41
ANKYR 12..232 CDD:440430 34/109 (31%)
ANK repeat 45..76 CDD:293786
ANK 2 45..74
ANK repeat 78..109 CDD:293786
ANK 3 78..107
ANK repeat 111..141 CDD:293786 3/17 (18%)
ANK 4 111..140 3/16 (19%)
ANK 5 144..173 9/28 (32%)
ANK repeat 144..172 CDD:293786 9/27 (33%)
ANK repeat 177..206 CDD:293786 10/28 (36%)
ANK 6 177..206 10/28 (36%)
ANK repeat 210..240 CDD:293786 11/22 (50%)
ANK 7 210..239 11/22 (50%)
TRPV 211..>292 CDD:454755 10/21 (48%)
ANK repeat 242..273 CDD:293786
ANK 8 242..271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.