DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31715 and MTPN

DIOPT Version :10

Sequence 1:NP_723568.1 Gene:CG31715 / 318909 FlyBaseID:FBgn0051715 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_665807.1 Gene:MTPN / 136319 HGNCID:15667 Length:118 Species:Homo sapiens


Alignment Length:116 Identity:59/116 - (50%)
Similarity:80/116 - (68%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIK-GRFPVHYAADFGQLNVLEFLISLGADINRKDK 69
            :::.:|.:|||:.|.|:| :....:.||..:: ||.|:|||||.|||.:||||:..|||||..||
Human     3 DKEFMWALKNGDLDEVKD-YVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDK 66

  Fly    70 HGITPILAAIWEGHTSCVELLLKMGADKNGSTPDGQSYLEAAEKDEIKKLL 120
            |.|||:|:|::|||.|||:|||..||||....|||.:..||.:...||.||
Human    67 HHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31715NP_723568.1 ANKYR <6..>120 CDD:440430 57/114 (50%)
ANK repeat 9..36 CDD:293786 9/26 (35%)
ANK repeat 38..68 CDD:293786 20/29 (69%)
ANK repeat 70..98 CDD:293786 18/27 (67%)
MTPNNP_665807.1 ANK 1 2..30 8/27 (30%)
ANKYR <6..>104 CDD:440430 53/98 (54%)
ANK repeat 6..32 CDD:293786 9/26 (35%)
ANK 2 34..66 20/31 (65%)
ANK repeat 34..65 CDD:293786 20/30 (67%)
ANK 3 67..99 19/31 (61%)
ANK repeat 67..97 CDD:293786 19/29 (66%)

Return to query results.
Submit another query.