DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and tpk2

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001038862.1 Gene:tpk2 / 751683 ZFINID:ZDB-GENE-060503-173 Length:297 Species:Danio rerio


Alignment Length:111 Identity:28/111 - (25%)
Similarity:46/111 - (41%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TALRETKEEA----GYDEKDLIIYKDTPL-TLNYQVQDK----PKIVIYWLAELRNPCQEPILSE 102
            |.::|.:|||    |..|      :..|: |::|..:|.    |:....:..||....|..|...
Zfish   180 TMVKECEEEACIPPGLAE------QARPVGTVSYTYEDDEGIFPECQFVFDLELPLNFQPHIGDG 238

  Fly   103 EHTDLKWLPKEEAKQCV---GFKDN--QVMIDKF--HQMILDQNKP 141
            |.....:.|.|:.|..:   .||.|  .|::|..  |.:|...::|
Zfish   239 EVQAFYYYPIEKVKDLLVSEEFKPNCAMVVLDFLIRHAIIEPDSEP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 25/101 (25%)
tpk2NP_001038862.1 DUF4743 8..129 CDD:292538
Nudix_hydrolase_3 97..275 CDD:239648 25/100 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.