DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Datp and Dcp2

DIOPT Version :10

Sequence 1:NP_723505.2 Gene:Datp / 318908 FlyBaseID:FBgn0287788 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_081766.1 Gene:Dcp2 / 70640 MGIID:1917890 Length:422 Species:Mus musculus


Alignment Length:95 Identity:28/95 - (29%)
Similarity:36/95 - (37%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEKDLIIYKD-TPLTLN------YQV 77
            ||::.......|..|||.|:..|.....|.||..||.|:|.||.|...| ..|.:|      |.:
Mouse   113 LLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYII 177

  Fly    78 QDKPKIV------------IYWLAELRNPC 95
            ...||..            |.|.:..:.||
Mouse   178 PGVPKDTKFNPKTRREIRNIEWFSIEKLPC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DatpNP_723505.2 NUDIX_Ap4A_Nudt2 1..135 CDD:467534 28/95 (29%)
Dcp2NP_081766.1 DCP2 12..93 CDD:428265
NUDIX_Dcp2p_Nudt20 97..246 CDD:467540 28/95 (29%)
Nudix box 129..150 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..347
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.