DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apf and Nudt2

DIOPT Version :9

Sequence 1:NP_723505.2 Gene:Apf / 318908 FlyBaseID:FBgn0051713 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_079815.2 Gene:Nudt2 / 66401 MGIID:1913651 Length:147 Species:Mus musculus


Alignment Length:139 Identity:64/139 - (46%)
Similarity:85/139 - (61%) Gaps:6/139 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAAGFVIFRRLC------GEIQYLLLKASYGSFHWSSPKGHVDPGEDDFTTALRETKEEAGYDEK 61
            :|.|.:||||..      ..|::|||:||.|..||:.|||||||||:|..||||||:||.|.:..
Mouse     4 RACGLIIFRRHLIPKMDNSTIEFLLLQASDGIHHWTPPKGHVDPGENDLETALRETREETGIEAS 68

  Fly    62 DLIIYKDTPLTLNYQVQDKPKIVIYWLAELRNPCQEPILSEEHTDLKWLPKEEAKQCVGFKDNQV 126
            .|.|.:.....|||..:.|||.|||||||:::...|..||:||...:||..|||.|...||:.:.
Mouse    69 QLTIIEGFRRELNYVARQKPKTVIYWLAEVKDYNVEIRLSQEHQAYRWLGLEEACQLAQFKEMKA 133

  Fly   127 MIDKFHQMI 135
            .:.:.||.:
Mouse   134 TLQEGHQFL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApfNP_723505.2 Ap4A_hydrolase_human_like 1..133 CDD:239520 62/135 (46%)
Nudt2NP_079815.2 Ap4A_hydrolase_human_like 2..140 CDD:239520 62/135 (46%)
Nudix box 43..64 16/20 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6539
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H896
Inparanoid 1 1.050 122 1.000 Inparanoid score I4738
Isobase 1 0.950 - 0 Normalized mean entropy S4140
OMA 1 1.010 - - QHG62350
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004403
OrthoInspector 1 1.000 - - oto92213
orthoMCL 1 0.900 - - OOG6_104771
Panther 1 1.100 - - LDO PTHR21340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2399
SonicParanoid 1 1.000 - - X4204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.